verygoods.co
🖥 Status: up
🕒 Response Time: 0.731 sec
⬅️ Response Code: 200
Starting February 13, 2019, verygoods.co's availability was tested 18 times over the following 2 738 day period. Verygoods.co functioned successfully 18 times in total checks performed, the last occurrence noted on April 11, 2026, returning a 200 status code. As of August 14, 2026, checks revealed that verygoods.co had no service interruptions. As of August 14, 2026, the responses obtained have been confirmed to be error status-free. Compared to its 0.731 seconds reply on April 11, 2026, verygoods.co's average response time is 0.811 seconds.
18
Last Updated: April 11, 2026
Verygoods overview
- Domain
- verygoods.co
- Title
- Verygoods
- V Site Status Rank
- 91 478
- Search Wikipedia
- verygoods.co
- Alternatives
- alternatives to verygoods.co
- Recently checked
- awsurveys.com
legslavishelite.com
Last Updated: July 6, 2026
Status: up
Response Time: 0.444 sec
Response Code: 200
actividadesdeinfantilyprimaria.com
Last Updated: May 10, 2026
Status: up
Response Time: 0.198 sec
Response Code: 200
greenvillejournal.com
Last Updated: July 3, 2026
Status: up
Response Time: 0.001 sec
Response Code: not set
e-modusvivendi.com
Last Updated: May 4, 2026
Status: error
Response Time: 0.028 sec
Response Code: 403
Verygoods.co
status check request map as of August 14, 2026
Country report for verygoods.co as of August 14, 2026
| Japan | 100.00% | ||||||||
| 11:13 | |||||||||
| Site | Total Checks | Last Modified |
|---|---|---|
| 3 | August 30, 2021 | |
| 14 | November 16, 2024 | |
| 18 | February 13, 2019 | |
| 16 | November 20, 2024 | |
| 21 | December 30, 2018 |
Greenvillejournal.com | Verygoods.co | ||||
|---|---|---|---|---|---|
General SEO Report
| Page Title | Page Title tips for verygoods.co: Juxtaposing related keywords within the website title can sometimes reveal compelling phrases that better capture user complexity and intent in the search, leading to higher engagement consistently. |
|---|---|
| no page title data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| Meta Description | Meta Description tips for verygoods.co: Meta descriptions convert search result clicks; think of them as landing page previews, so make every character count by being concise (under 160 characters), question-focused, or action-oriented while naturally including your primary keyword. |
| no meta description data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| Meta Keywords | Meta Keywords tips for verygoods.co: Think of meta keywords; the usefulness levels with Google? It's practically invisible to the algorithms outlining core ranking factors today like Core Web Vital metrics, domain authority, and topical relevance |
| no meta keywords data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| Page Content | Page Content tips for verygoods.co: Structure your page content with clear headings, subheadings, and bullet points to enhance readability, improve user engagement, and signal content hierarchy to search engine crawlers for better indexing. |
| no page content data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| H1 Heading | H1 Heading tips for verygoods.co: When editing an existing webpage, manually review all headings on the list to ensure they accurately reflect the main topic of the surrounding paragraph, providing semantic structure that benefits both user experience and SEO ranking efforts |
| no h1 heading data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| H2 Headings | H2 Headings tips for verygoods.co: To avoid keyword stuffing, integrate naturally related secondary keywords and long-tail phrases within well-phrased H2 headings that accurately reflect the section's content. |
| no h2 headings data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| H3 Headings | H3 Headings tips for verygoods.co: Avoid overusing H3 tags excessively or placing them in an unbalanced hierarchy; respect the HTML <hgroup> tags and ensure clear visual progression down to lower-level headings (like H4, H5) for enhanced readability and SEO effectiveness. |
| no h3 headings data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| H4 Headings | H4 Headings tips for verygoods.co: H4 tags are an organic part of enforcing SEO best practices; their correct implementation (aligned with text content) demonstrates to Google your commitment to quality code and website structure fundamentals. |
| no h4 headings data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| H5-H6 Headings | H5-H6 Headings tips for verygoods.co: The effectiveness of using H5 or H6 headers lies in their role as signposts; when they clearly delimit content segments, crawlers can better map the topic coverage scope on your dedicated content pages. |
| no h5-h6 headings data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| Image ALT Attributes | Image ALT Attributes tips for verygoods.co: Alt text is crucial for content discovery beyond text-based search; search engines use it to determine what an image represents, influencing how the visual media is categorized and thus how easily potential users can find and engage with your website content through image search. |
| no image alt attributes data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| Robots.txt | Robots.txt tips for verygoods.co: Beware of accidentally blocking your robots.txt file itself listed in a Disallow rule, primarily by user agents, which prevents search engines from seeing the intended directives and causes all subsequent crawling behavior to default to potentially unfavorable interpretations. |
| no robots.txt data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| XML Sitemap | XML Sitemap tips for verygoods.co: A well-maintained XML sitemap enhances website crawlability, allowing search engines to efficiently identify and index less obvious pages, thereby preventing valuable content from ranking. |
| no xml sitemap data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| Page Size | Page Size tips for verygoods.co: Smaller page size means less data transferred, which is crucial for reducing bounce rates not just among mobile users but across all device types, especially those with limited bandwidth or slower connections. |
| page size: 0 kb | |
| Response Time | Response Time tips for verygoods.co: Employ layers of reverse proxy caching strategically positioned before your application serverstack to serve valid cached responses for frequently accessed assets, significantly reducing effective round trip times and lowering average website response times substantially. |
| response time: 0.811 sec | |
| Minify CSS | Minify CSS tips for verygoods.co: PageSpeed Insights, as helpful web optimization tools, will suggest minifying unused CSS aggressively; pay attention to these recommendations to automatically boost Core Web Vitals. |
| no minify css data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| Minify JavaScript | Minify JavaScript tips for verygoods.co: Failure to minify JavaScript can lead to bloated files that considerably delay page rendering times, negatively affecting user experience and crucial SEO signals picked up by crawlers looking for minified optimization techniques to deliver faster page speeds compared to competitors. |
| no minify javascript data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| Structured Data | Structured Data tips for verygoods.co: Beyond basic meta tags, Schema Markup provides a structured format that search engines utilize to decipher complex content, like detailed recipes with unique ingredients or comprehensive software feature lists, thereby improving semantic relevance and content discoverability online. |
| no structured data data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| CDN Usage | CDN Usage tips for verygoods.co: Utilize browser caching mechanisms suggested by CDN providers where available, setting high max-age values instructing clients to locally cache frequently used CSS frameworks and fonts, lessening the initial load burden. |
| no cdn usage data for verygoods.co 2026-08-14T00:42:03+00:00 | |
| SSL certificates | SSL certificates tips for verygoods.co: SSL certificates are instrumental in bolstering website security defenses against a wide array of cyber threats including man-in-the-middle attacks and session hijacking, thereby protecting end-users from potential identity theft and preserving your brand reputation by ensuring data privacy. |
| no ssl certificates data for verygoods.co 2026-08-14T00:42:03+00:00 |
Estimated Traffic
| Minimum Daily Unique Visitors: | 5 213 |
| Minimum Daily Visits: | 6 093 |
| Minimum Daily Page Views: | 10 489 |
| Minimum Monthly Unique Visitors: | 156 390 |
| Minimum Monthly Visits: | 182 790 |
| Minimum Monthly Page Views: | 314 670 |
| Minimum Yearly Unique Visitors: | 1 876 680 |
| Minimum Yearly Visits: | 2 193 480 |
| Minimum Yearly Page Views: | 3 776 040 |
| Maximum Daily Unique Visitors: | 6 595 |
| Maximum Daily Visits: | 7 035 |
| Maximum Daily Page Views: | 11 871 |
| Maximum Monthly Unique Visitors: | 197 850 |
| Maximum Monthly Visits: | 211 050 |
| Maximum Monthly Page Views: | 356 130 |
| Maximum Yearly Unique Visitors: | 2 374 200 |
| Maximum Yearly Visits: | 2 532 600 |
| Maximum Yearly Page Views: | 4 273 560 |
Estimated Valuation
| Daily Revenue: | US$ 8 - 17 |
| Monthly Revenue: | US$ 240 - 510 |
| Yearly Revenue: | US$ 2 880 - 6 120 |
Estimated Worth
| Minimum: | US$ 4 320 |
| Maximum: | US$ 18 360 |
Similarly Ranked Sites
| Rank | Points | |
|---|---|---|
| 206 776 | 6 114 013 | |
| 206 777 | 6 114 013 | |
| 206 778 | 6 114 012 | |
| 206 779 | 6 114 012 | |
| 206 780 | 6 114 011 | |
| 206 781 | 6 114 011 | |
| 206 782 | 6 114 010 | |
| 206 783 | 6 114 010 | |
| 206 784 | 6 114 009 | |
| 206 785 | 6 114 009 | |
| 206 786 | 6 114 009 |